Loading...
Statistics
Cotton's Journey
www.cottonsjourney.com/
Cotton's Journey-A Field Trip in A Box - The only cotton education site for classroom teachers providing curriculum, literature resources, links to cotton ...
Cottonsjourney.com
Cottonsjourney.com is hosted in
United States
.
Cottonsjourney.com uses HTTPS protocol.
Number of used technologies:
3.
First technologies:
CSS, Html, Javascript,
Number of used javascripts: 0.
First javascripts:
Number of used analytics tools:
0.
Its server type is:
Microsoft-IIS/5.0.
Technologies in use by Cottonsjourney.com
Technology
Number of occurences: 3
- CSS
- Html
- Javascript
Advertisement
Javascripts
Number of occurences: 0
Server Type
- Microsoft-IIS/5.0
Powered by
- ASP.NET
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Not founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Cottonsjourney.com
SSL certificate
- name: /O=www.foxhanford.com/OU=Go to https://www.thawte.com/repository/index.html/OU=Thawte SSL123 certificate/OU=Domain Validated/CN=www.foxhanford.com
- subject:
- O: www.foxhanford.com
- OU:
- 0: Go to https://www.thawte.com/repository/index.html
- 1: Thawte SSL123 certificate
- 2: Domain Validated
- CN: www.foxhanford.com
- hash: 8e9170e0
- issuer:
- C: US
- O: Thawte, Inc.
- OU: Domain Validated SSL
- CN: Thawte DV SSL CA
- version: 2
- serialNumber: 128332888629282316098347305596840469840
- validFrom: 111003000000Z
- validTo: 131101235959Z
- validFrom_time_t: 1317600000
- validTo_time_t: 1383350399
- extensions:
- basicConstraints: CA:FALSE
- crlDistributionPoints: Full Name: URI:http://svr-dv-crl.thawte.com/ThawteDV.crl
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- authorityInfoAccess: OCSP - URI:http://ocsp.thawte.com
Number of occurences: 3
- Name:
Content: text/html; charset=iso-8859-1 - Name: description
Content: Cotton's Journey-A Field Trip in A Box - The only cotton education site for classroom teachers providing curriculum, literature resources, links to cotton and educational organizations promoting the importance of this crop, and the story of cotton-from seed to you. - Name: keywords
Content: cotton, education, fiber, textile, lesson, teacher, cottonseed, oil, plant, seed, curriculum, classroom, fabric, cloth, crop, farming, quilt, history, mill, gin, pima, upland, literature, science, language arts, resource
Server / Hosting
- IP: 75.150.2.227
- Latitude: 37.75
- Longitude: -97.82
- Country: United States
Rname
- ns1.gfoo.com
- mail.cottonsjourney.com
Target
- admin
HTTP Header Response
HTTP/1.1 200 OK
Server: Microsoft-IIS/5.0
Date: Sat, 23 Apr 2016 11:39:43 GMT
X-Powered-By: ASP.NET
Content-Length: 41320
Content-Type: text/html
Set-Cookie: ASPSESSIONIDAARCSCCB=HBECABODJCFGHJKHFBBFBBEL; path=/
Cache-control: private
DNS
host: cottonsjourney.com
- class: IN
- ttl: 3598
- type: A
- ip: 75.150.2.227
host: cottonsjourney.com
- class: IN
- ttl: 3600
- type: NS
- target: ns1.gfoo.com
host: cottonsjourney.com
- class: IN
- ttl: 3600
- type: SOA
- mname: ns1gfoo
- rname: admin
- serial: 9
- refresh: 900
- retry: 600
- expire: 86400
- minimum-ttl: 3600
host: cottonsjourney.com
- class: IN
- ttl: 1186
- type: MX
- pri: 10
- target: mail.cottonsjourney.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.ottonsjourney.com, www.cdottonsjourney.com, www.dottonsjourney.com, www.crottonsjourney.com, www.rottonsjourney.com, www.ctottonsjourney.com, www.tottonsjourney.com, www.cvottonsjourney.com, www.vottonsjourney.com, www.cfottonsjourney.com, www.fottonsjourney.com, www.cgottonsjourney.com, www.gottonsjourney.com, www.chottonsjourney.com, www.hottonsjourney.com, www.cnottonsjourney.com, www.nottonsjourney.com, www.cmottonsjourney.com, www.mottonsjourney.com, www.cjottonsjourney.com, www.jottonsjourney.com, www.cttonsjourney.com, www.cobttonsjourney.com, www.cbttonsjourney.com, www.cohttonsjourney.com, www.chttonsjourney.com, www.cogttonsjourney.com, www.cgttonsjourney.com, www.cojttonsjourney.com, www.cjttonsjourney.com, www.comttonsjourney.com, www.cmttonsjourney.com, www.co ttonsjourney.com, www.c ttonsjourney.com, www.covttonsjourney.com, www.cvttonsjourney.com, www.cotonsjourney.com, www.cotqtonsjourney.com, www.coqtonsjourney.com, www.cotatonsjourney.com, www.coatonsjourney.com, www.cot tonsjourney.com, www.co tonsjourney.com, www.cotwtonsjourney.com, www.cowtonsjourney.com, www.cotetonsjourney.com, www.coetonsjourney.com, www.cotztonsjourney.com, www.coztonsjourney.com, www.cotxtonsjourney.com, www.coxtonsjourney.com, www.cotctonsjourney.com, www.coctonsjourney.com, www.cotonsjourney.com, www.cottqonsjourney.com, www.cotqonsjourney.com, www.cottaonsjourney.com, www.cotaonsjourney.com, www.cott onsjourney.com, www.cot onsjourney.com, www.cottwonsjourney.com, www.cotwonsjourney.com, www.cotteonsjourney.com, www.coteonsjourney.com, www.cottzonsjourney.com, www.cotzonsjourney.com, www.cottxonsjourney.com, www.cotxonsjourney.com, www.cottconsjourney.com, www.cotconsjourney.com, www.cottnsjourney.com, www.cottobnsjourney.com, www.cottbnsjourney.com, www.cottohnsjourney.com, www.cotthnsjourney.com, www.cottognsjourney.com, www.cottgnsjourney.com, www.cottojnsjourney.com, www.cottjnsjourney.com, www.cottomnsjourney.com, www.cottmnsjourney.com, www.cotto nsjourney.com, www.cott nsjourney.com, www.cottovnsjourney.com, www.cottvnsjourney.com, www.cottosjourney.com, www.cottonnsjourney.com, www.cottonsjourney.com, www.cottonhsjourney.com, www.cottohsjourney.com, www.cottonjsjourney.com, www.cottojsjourney.com, www.cottonksjourney.com, www.cottoksjourney.com, www.cottonlsjourney.com, www.cottolsjourney.com, www.cotton sjourney.com, www.cotto sjourney.com, www.cottonjourney.com, www.cottonsejourney.com, www.cottonejourney.com, www.cottonswjourney.com, www.cottonwjourney.com, www.cottonsdjourney.com, www.cottondjourney.com, www.cottonsxjourney.com, www.cottonxjourney.com, www.cottonsfjourney.com, www.cottonfjourney.com, www.cottonsgjourney.com, www.cottongjourney.com, www.cottonstjourney.com, www.cottontjourney.com, www.cottonsourney.com, www.cottonsjzourney.com, www.cottonszourney.com, www.cottonsjhourney.com, www.cottonshourney.com, www.cottonsjnourney.com, www.cottonsnourney.com, www.cottonsj.ourney.com, www.cottons.ourney.com, www.cottonsjuourney.com, www.cottonsuourney.com, www.cottonsjkourney.com, www.cottonskourney.com, www.cottonsjlourney.com, www.cottonslourney.com, www.cottonsjoourney.com, www.cottonsoourney.com, www.cottonsjurney.com, www.cottonsjoburney.com, www.cottonsjburney.com, www.cottonsjohurney.com, www.cottonsjhurney.com, www.cottonsjogurney.com, www.cottonsjgurney.com, www.cottonsjojurney.com, www.cottonsjjurney.com, www.cottonsjomurney.com, www.cottonsjmurney.com, www.cottonsjo urney.com, www.cottonsj urney.com, www.cottonsjovurney.com, www.cottonsjvurney.com, www.cottonsjorney.com, www.cottonsjouwrney.com, www.cottonsjowrney.com, www.cottonsjouerney.com, www.cottonsjoerney.com, www.cottonsjousrney.com, www.cottonsjosrney.com, www.cottonsjouarney.com, www.cottonsjoarney.com, www.cottonsjouney.com, www.cottonsjouriney.com, www.cottonsjouiney.com, www.cottonsjouroney.com, www.cottonsjouoney.com, www.cottonsjourlney.com, www.cottonsjoulney.com, www.cottonsjourlney.com, www.cottonsjoulney.com, www.cottonsjour.ney.com, www.cottonsjou.ney.com,
Other websites we recently analyzed
- DUI in New Jersey - Experienced Traffic Ticket Attorney defense in NJ
A local DUI Attorney can help you understand the specific DUI Laws in your State. Each State has different laws, penalties and fines when it comes to a DUI conviction.Red Bank (United States) - 96.234.32.5
Server software: Microsoft-IIS/8.5
Technology: CSS, Html, Javascript, Swf Object, Google Analytics
Number of Javascript: 4
Number of meta tags: 10 - singletravelersmakingnewfriends.com
United States - 192.195.77.18
Server software: Apache
Technology: Html
Number of meta tags: 1 - åå¤å±‹å¸‚天白区ã®æ¯ç§‘治療ã¯å¡©é‡œå£å¾’æ©ï¼‘分ã„ã¨ã†æ¯ç§‘ã¸
ã„ã¨ã†æ¯ç§‘ã¯åå¤å±‹å¸‚天白区ã®å¡©é‡œå£é§…ã‹ã‚‰å¾’æ©1分。地域ã®æ¯åŒ»è€…ã¨ã—30年以上ã€ã„ã¨ã†æ¯ç§‘ã¯è²¢çŒ®ã—ã¦ã¾ã„ã‚Šã¾ã—ãŸã€‚Japan - 110.50.245.14
Server software: Apache/2.2.3 (Red Hat)
Technology: CSS, Html, Iframe, Javascript, jQuery Cookie, Google Analytics
Number of Javascript: 10
Number of meta tags: 4 - ã¸ã“ã¿ã®ã‚る車ã®æŸ»å®šé¡ã¯ã©ã‚Œãらã„？
ã¸ã“ã¿ã®ã‚る車ã®æŸ»å®šé¡ã¯ã©ã‚Œãらã„？ã¨ã„ã†ã“ã¨ã«ã¤ã„ã¦æ›¸ã„ã¦ã„ã¾ã™ã€‚Osaka (Japan) - 112.78.117.105
Server software: Apache
Technology: CSS, Google Font API, Html, Html5, jQuery, Php, Pingback, Wordpress
Number of Javascript: 4
Number of meta tags: 5 - turfdigest.com
United States - 208.91.197.27
Server software: Apache
Technology: Html
Number of meta tags: 2 - Gemeinschaftspraxis - Dr. med Zeschnigk & Tin
Germany - 217.160.223.108
Server software: Apache
Technology: CSS, Html, Javascript, jQuery, jQuery Cycle, Php
Number of Javascript: 2
Number of meta tags: 1 - מעליות | מעלית - כל ליפט
מעליות - כל ליפט חברת ×חזקת מעליות, שירות מעליות, חילוץ מעליות ועוד. כל ליפט מעליות.Israel - 212.199.115.180
Server software: Apache/2.0.52 (CentOS)
Technology: CSS, Html, Javascript, Swf Object
Number of Javascript: 5
Number of meta tags: 6 - Goshna
Provo (United States) - 192.163.249.186
Server software: Apache
Technology: AJAX Libraries API, CSS, Html, Iframe, Google Analytics
Number of Javascript: 2
Number of meta tags: 1 - Peluquería, Salón de Belleza
Spain - 195.162.19.211
Server software: Apache
Technology: Html
Number of meta tags: 1 - bhyxy.org
Austin (United States) - 209.99.40.224
Server software: Apache
Technology: Html
Number of meta tags: 2